PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6BL_8E4A831B6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 141aa    MW: 16658.1 Da    PI: 11.4545
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6BL_8E4A831B6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171562148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed+ll+ +v+q G g+W+++a+  g++R++k+c++rw +yl
  Traes_6BL_8E4A831B6.1 15 KGPWTAQEDKLLLGYVRQQGEGRWNSVAKLTGLKRSGKSCRLRWVNYL 62
                           79********************************************97 PP

2Myb_DNA-binding52.71e-1668112147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Traes_6BL_8E4A831B6.1  68 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 112
                            8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1751062IPR017930Myb domain
SuperFamilySSF466895.99E-3013109IPR009057Homeodomain-like
SMARTSM007171.1E-131464IPR001005SANT/Myb domain
PfamPF002492.3E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-231669IPR009057Homeodomain-like
CDDcd001673.51E-91762No hitNo description
PROSITE profilePS5129424.93363117IPR017930Myb domain
SMARTSM007174.5E-1567115IPR001005SANT/Myb domain
PfamPF002491.8E-1468112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2470115IPR009057Homeodomain-like
CDDcd001673.47E-972113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MEQFGWGREE GGWRKGPWTA QEDKLLLGYV RQQGEGRWNS VAKLTGLKRS GKSCRLRWVN  60
YLRPDLKRGK ITPQEESVIL ELHALWGNRW STIARSLPGR TDNEIKNYWR THFKKGKPSS  120
KNIERARARF LKQRREIMQG H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26151157106B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0992831e-134AK099283.1 Oryza sativa Japonica Group cDNA clone:J023132O17, full insert sequence.
GenBankAK1118071e-134AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572719.12e-93PREDICTED: myb-related protein Zm38
SwissprotQ9LX822e-51MYB48_ARATH; Transcription factor MYB48
TrEMBLW5GL072e-99W5GL07_WHEAT; Uncharacterized protein
TrEMBLW5H1612e-99W5H161_WHEAT; Uncharacterized protein
STRINGMLOC_6786.12e-96(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.12e-67myb domain protein 79
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]